SCOPe 2.05: Domain d2dkpa_: 2dkp A:

Lineage for d2dkpa_ (2dkp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d2dkpa_: 2dkp A: [241583]
   automated match to d1upqa_

Details for d2dkpa_

PDB Entry: 2dkp

PDB Description: solution structure of the ph domain of pleckstrin homology domain- containing protein family a member 5 from human

PDB Compounds: (A:) Pleckstrin homology domain-containing family A member 5

SCOPe Domain Sequences for d2dkpa_:

Sequence; same for both SEQRES and ATOM records:

>d2dkpa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkrsnsikrnpnapvvrrgwlykqdstgmklwkkrwfvlsdlclfyyrdekeeg
ilgsillpsfqialltsedhinrkyafkaahpnmrtyyfctdtgkemelwmkamldaalv
qtsgpssg

Timeline for d2dkpa_:

• d2dkpa_ first appeared in SCOPe 2.04
  
• d2dkpa_ is called d2dkpa1 in SCOPe 2.06
  
• d2dkpa_ appears in the current release, SCOPe 2.08, called d2dkpa1