PDB entry 2dkp

View 2dkp on RCSB PDB site
Description: Solution structure of the PH domain of pleckstrin homology domain-containing protein family A member 5 from human
Class: signaling protein
Keywords: PH domain, Pleckstrin homology domain-containing protein family A member 5, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-13, released 2006-10-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin homology domain-containing family A member 5
  Species: Homo sapiens [TaxId:9606]
  Gene: PLEKHA5, KIAA1686, PEPP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HAU0 (7-121)
    • cloning artifact (0-6)
    • cloning artifact (122-127)
  Domains in SCOPe 2.05: d2dkpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dkpA (A:)
  gssgssgkrsnsikrnpnapvvrrgwlykqdstgmklwkkrwfvlsdlclfyyrdekeeg
  ilgsillpsfqialltsedhinrkyafkaahpnmrtyyfctdtgkemelwmkamldaalv
  qtsgpssg