Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (10 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:1772] [254961] (3 PDB entries) |
Domain d1x3gb_: 1x3g B: [240950] automated match to d1ue1b_ complexed with cd |
PDB Entry: 1x3g (more details), 3 Å
SCOPe Domain Sequences for d1x3gb_:
Sequence, based on SEQRES records: (download)
>d1x3gb_ b.40.4.3 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} gdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwre aaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
>d1x3gb_ b.40.4.3 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]} gdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwre aaenvaesltrgsrvivtgrlkqrsfetrkrtvvevevdeigpslryatakvnka
Timeline for d1x3gb_: