SCOPe 2.07: Domain d4ohja2: 4ohj A:134-234

Lineage for d4ohja2 (4ohj A:134-234)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225595] (3 PDB entries)

8. Domain d4ohja2: 4ohj A:134-234 [240700]
   Other proteins in same PDB: d4ohja1, d4ohja3, d4ohjb1, d4ohjb3
   automated match to d4ohjb2

Details for d4ohja2

PDB Entry: 4ohj, 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohja2:

Sequence; same for both SEQRES and ATOM records:

>d4ohja2 d.15.6.1 (A:134-234) automated matches {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d4ohja2:

• d4ohja2 first appeared in SCOPe 2.04
  
• d4ohja2 appears in SCOPe 2.06
  
• d4ohja2 appears in the current release, SCOPe 2.08