![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein automated matches [226992] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [225594] (2 PDB entries) |
![]() | Domain d4ohjb1: 4ohj B:40-133 [236649] Other proteins in same PDB: d4ohja2, d4ohja3, d4ohjb2, d4ohjb3 automated match to d2tssa1 |
PDB Entry: 4ohj (more details), 1.28 Å
SCOPe Domain Sequences for d4ohjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohjb1 b.40.2.2 (B:40-133) automated matches {Staphylococcus aureus [TaxId: 1280]} astndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkg ekvdlntkrtkksqhtsegtyihfqisgvtntek
Timeline for d4ohjb1: