Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein automated matches [226944] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225595] (3 PDB entries) |
Domain d4ohjb2: 4ohj B:134-234 [236650] Other proteins in same PDB: d4ohja1, d4ohja3, d4ohjb1, d4ohjb3 automated match to d1aw7a2 |
PDB Entry: 4ohj (more details), 1.28 Å
SCOPe Domain Sequences for d4ohjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ohjb2 d.15.6.1 (B:134-234) automated matches {Staphylococcus aureus [TaxId: 1280]} lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d4ohjb2: