Lineage for d4ohja2 (4ohj A:134-235)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639412Protein automated matches [226944] (2 species)
    not a true protein
  7. 1639413Species Staphylococcus aureus [TaxId:1280] [225595] (2 PDB entries)
  8. 1639415Domain d4ohja2: 4ohj A:134-235 [240700]
    Other proteins in same PDB: d4ohja1, d4ohjb1
    automated match to d4ohjb2

Details for d4ohja2

PDB Entry: 4ohj (more details), 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohja2 d.15.6.1 (A:134-235) automated matches {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaeing

SCOPe Domain Coordinates for d4ohja2:

Click to download the PDB-style file with coordinates for d4ohja2.
(The format of our PDB-style files is described here.)

Timeline for d4ohja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ohja1