Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries) |
Domain d4nhdb1: 4nhd B:0-174 [240630] complexed with ca, coa, na |
PDB Entry: 4nhd (more details), 1.78 Å
SCOPe Domain Sequences for d4nhdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhdb1 c.95.1.0 (B:0-174) automated matches {Vibrio cholerae [TaxId: 243277]} amyskilgtgsylpsqvrtnadlekmvetsdewivartgirerriaadnetvadmaffaa qnainmagidkhdidmiivattsashtfpsaacqvqgklgikgcpafdlaaacsgfmyal siadqhvksgmckhvlvigadalsktcdptdrstiilfgdgagavvvgasnepgi
Timeline for d4nhdb1: