SCOPe 2.05: Domain d4nhdd1: 4nhd D:-1-174

Lineage for d4nhdd1 (4nhd D:-1-174)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)

8. Domain d4nhdd1: 4nhd D:-1-174 [240634]
   complexed with ca, coa, na

Details for d4nhdd1

PDB Entry: 4nhd, 1.78 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii (fabh) from vibrio cholerae in complex with coenzyme a

PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

SCOPe Domain Sequences for d4nhdd1:

Sequence; same for both SEQRES and ATOM records:

>d4nhdd1 c.95.1.0 (D:-1-174) automated matches {Vibrio cholerae [TaxId: 243277]}
namyskilgtgsylpsqvrtnadlekmvetsdewivartgirerriaadnetvadmaffa
aqnainmagidkhdidmiivattsashtfpsaacqvqgklgikgcpafdlaaacsgfmya
lsiadqhvksgmckhvlvigadalsktcdptdrstiilfgdgagavvvgasnepgi

Timeline for d4nhdd1:

• d4nhdd1 first appeared in SCOPe 2.04
  
• d4nhdd1 appears in SCOPe 2.06
  
• d4nhdd1 appears in the current release, SCOPe 2.08