Lineage for d4nhdd2 (4nhd D:175-316)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1882350Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries)
  8. 1882366Domain d4nhdd2: 4nhd D:175-316 [240635]
    complexed with ca, coa, na

Details for d4nhdd2

PDB Entry: 4nhd (more details), 1.78 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii (fabh) from vibrio cholerae in complex with coenzyme a
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1

SCOPe Domain Sequences for d4nhdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhdd2 c.95.1.0 (D:175-316) automated matches {Vibrio cholerae [TaxId: 243277]}
lsthihadgefgdllslevpvrggdsdkwlhmagnevfkvavtqlsklvvdtlkannmhk
seldwlvphqanyriisatakklsmsldqvvitldrhgntsaatvptaldeavrdgriqr
gqmllleafgggftwgsalvkf

SCOPe Domain Coordinates for d4nhdd2:

Click to download the PDB-style file with coordinates for d4nhdd2.
(The format of our PDB-style files is described here.)

Timeline for d4nhdd2: