Lineage for d4mqwg_ (4mqw G:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260649Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 2260659Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 2260660Species Human (Homo sapiens) [TaxId:9606] [63397] (9 PDB entries)
  8. 2260666Domain d4mqwg_: 4mqw G: [240545]
    Other proteins in same PDB: d4mqwb_, d4mqwe_, d4mqwh_
    automated match to d4mqwa_
    complexed with edo, jef, nag

Details for d4mqwg_

PDB Entry: 4mqw (more details), 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
PDB Compounds: (G:) glycoprotein hormones, alpha polypeptide

SCOPe Domain Sequences for d4mqwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqwg_ g.17.1.4 (G:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
qdcpectlqenplfsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaks
ynrvtvmggfkvenhtachcstcyyhks

SCOPe Domain Coordinates for d4mqwg_:

Click to download the PDB-style file with coordinates for d4mqwg_.
(The format of our PDB-style files is described here.)

Timeline for d4mqwg_: