SCOPe 2.06: Domain d4mqwe_: 4mqw E:

Lineage for d4mqwe_ (4mqw E:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)

8. Domain d4mqwe_: 4mqw E: [238441]
   Other proteins in same PDB: d4mqwa_, d4mqwd_, d4mqwg_
   automated match to d4ay9h_
   complexed with edo, jef, nag

Details for d4mqwe_

PDB Entry: 4mqw, 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)

PDB Compounds: (E:) follitropin subunit beta

SCOPe Domain Sequences for d4mqwe_:

Sequence; same for both SEQRES and ATOM records:

>d4mqwe_ g.17.1.4 (E:) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfge

Timeline for d4mqwe_:

• d4mqwe_ first appeared in SCOPe 2.03
  
• d4mqwe_ appears in SCOPe 2.05
  
• d4mqwe_ appears in SCOPe 2.07
  
• d4mqwe_ appears in the current release, SCOPe 2.08