Class g: Small proteins [56992] (94 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) |
Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries) |
Domain d4mqwe_: 4mqw E: [238441] Other proteins in same PDB: d4mqwa_, d4mqwd_, d4mqwg_ automated match to d4ay9h_ complexed with edo, jef, nag |
PDB Entry: 4mqw (more details), 2.9 Å
SCOPe Domain Sequences for d4mqwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqwe_ g.17.1.4 (E:) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]} nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfge
Timeline for d4mqwe_: