Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) |
Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63397] (9 PDB entries) |
Domain d4mqwg_: 4mqw G: [240545] Other proteins in same PDB: d4mqwb_, d4mqwe_, d4mqwh_ automated match to d4mqwa_ complexed with edo, jef, nag |
PDB Entry: 4mqw (more details), 2.9 Å
SCOPe Domain Sequences for d4mqwg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqwg_ g.17.1.4 (G:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]} qdcpectlqenplfsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaks ynrvtvmggfkvenhtachcstcyyhks
Timeline for d4mqwg_: