SCOPe 2.07: Domain d4mqwg_: 4mqw G:

Lineage for d4mqwg_ (4mqw G:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63397] (9 PDB entries)

8. Domain d4mqwg_: 4mqw G: [240545]
   Other proteins in same PDB: d4mqwb_, d4mqwe_, d4mqwh_
   automated match to d4mqwa_
   complexed with edo, jef, nag

Details for d4mqwg_

PDB Entry: 4mqw, 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)

PDB Compounds: (G:) glycoprotein hormones, alpha polypeptide

SCOPe Domain Sequences for d4mqwg_:

Sequence; same for both SEQRES and ATOM records:

>d4mqwg_ g.17.1.4 (G:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens) [TaxId: 9606]}
qdcpectlqenplfsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaks
ynrvtvmggfkvenhtachcstcyyhks

Timeline for d4mqwg_:

• d4mqwg_ first appeared in SCOPe 2.04
  
• d4mqwg_ appears in SCOPe 2.06
  
• d4mqwg_ appears in the current release, SCOPe 2.08