Lineage for d4hlzd_ (4hlz D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041399Domain d4hlzd_: 4hlz D: [240210]
    Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzc1, d4hlzc2, d4hlze1, d4hlze2, d4hlzg1, d4hlzg2, d4hlzh1, d4hlzh2, d4hlzi_, d4hlzj1, d4hlzj2, d4hlzk_, d4hlzl1, d4hlzl2
    automated match to d2viub_
    complexed with edo, nag, so4

Details for d4hlzd_

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4hlzd_:

Sequence, based on SEQRES records: (download)

>d4hlzd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

Sequence, based on observed residues (ATOM records): (download)

>d4hlzd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
teavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkv
rmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d4hlzd_:

Click to download the PDB-style file with coordinates for d4hlzd_.
(The format of our PDB-style files is described here.)

Timeline for d4hlzd_: