Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d4hlzj2: 4hlz J:110-214 [222668] Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzb_, d4hlzc1, d4hlzc2, d4hlzd_, d4hlze1, d4hlze2, d4hlzf_, d4hlzg1, d4hlzg2, d4hlzh1, d4hlzi_, d4hlzj1, d4hlzk_, d4hlzl1 automated match to d1dqdl2 complexed with edo, nag, so4 |
PDB Entry: 4hlz (more details), 2.9 Å
SCOPe Domain Sequences for d4hlzj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlzj2 b.1.1.2 (J:110-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4hlzj2: