SCOPe 2.08: Domain d4hlzj2: 4hlz J:110-214

Lineage for d4hlzj2 (4hlz J:110-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4hlzj2: 4hlz J:110-214 [222668]
   Other proteins in same PDB: d4hlza1, d4hlza2, d4hlzb_, d4hlzc1, d4hlzc2, d4hlzd_, d4hlze1, d4hlze2, d4hlzf_, d4hlzg1, d4hlzg2, d4hlzh1, d4hlzi_, d4hlzj1, d4hlzk_, d4hlzl1
   automated match to d1dqdl2
   complexed with edo, nag, so4

Details for d4hlzj2

PDB Entry: 4hlz, 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin

PDB Compounds: (J:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzj2:

Sequence; same for both SEQRES and ATOM records:

>d4hlzj2 b.1.1.2 (J:110-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4hlzj2:

• d4hlzj2 first appeared in SCOPe 2.03
  
• d4hlzj2 appears in SCOPe 2.07