SCOPe 2.08: Domain d3rtld1: 3rtl D:341-456

Lineage for d3rtld1 (3rtl D:341-456)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)

8. Domain d3rtld1: 3rtl D:341-456 [239706]
   Other proteins in same PDB: d3rtla2, d3rtlb2, d3rtlc2, d3rtld2
   automated match to d3rtlb_
   complexed with cl, hem, mg

Details for d3rtld1

PDB Entry: 3rtl, 1.45 Å

PDB Description: staphylococcus aureus heme-bound isdb-n2

PDB Compounds: (D:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rtld1:

Sequence; same for both SEQRES and ATOM records:

>d3rtld1 b.1.28.0 (D:341-456) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftk

Timeline for d3rtld1:

• d3rtld1 first appeared in SCOPe 2.04, called d3rtld_
  
• d3rtld1 appears in SCOPe 2.07