Class a: All alpha proteins [46456] (285 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255272] (5 PDB entries) |
Domain d2v7qc3: 2v7q C:380-510 [238884] Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qb1, d2v7qb2, d2v7qc1, d2v7qc2, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_ automated match to d1maba1 complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qc3:
Sequence, based on SEQRES records: (download)
>d2v7qc3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke ivtnflagfea
>d2v7qc3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaldaatqqllsrgvrltellkqgqyspmaieeqvav iyagvrgyldklepskitkfenaflshvisqhqallskidaklkeivtnflagfea
Timeline for d2v7qc3: