Lineage for d2v7qc3 (2v7q C:380-510)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494900Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1494901Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1495029Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1495030Protein automated matches [254528] (6 species)
    not a true protein
  7. 1495086Species Cow (Bos taurus) [TaxId:9913] [255272] (5 PDB entries)
  8. 1495089Domain d2v7qc3: 2v7q C:380-510 [238884]
    Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qb1, d2v7qb2, d2v7qc1, d2v7qc2, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
    automated match to d1maba1
    complexed with adp, atp, mg, po4

Details for d2v7qc3

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (C:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2v7qc3:

Sequence, based on SEQRES records: (download)

>d2v7qc3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d2v7qc3 a.69.1.0 (C:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaldaatqqllsrgvrltellkqgqyspmaieeqvav
iyagvrgyldklepskitkfenaflshvisqhqallskidaklkeivtnflagfea

SCOPe Domain Coordinates for d2v7qc3:

Click to download the PDB-style file with coordinates for d2v7qc3.
(The format of our PDB-style files is described here.)

Timeline for d2v7qc3: