Lineage for d2v7qi_ (2v7q I:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505912Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1506058Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 1506059Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 1506064Protein automated matches [190373] (1 species)
    not a true protein
  7. 1506065Species Cow (Bos taurus) [TaxId:9913] [187216] (4 PDB entries)
  8. 1506067Domain d2v7qi_: 2v7q I: [152735]
    Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qj_
    automated match to d1e79i_
    complexed with adp, atp, mg, po4

Details for d2v7qi_

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (I:) ATP synthase epsilon chain

SCOPe Domain Sequences for d2v7qi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qi_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

SCOPe Domain Coordinates for d2v7qi_:

Click to download the PDB-style file with coordinates for d2v7qi_.
(The format of our PDB-style files is described here.)

Timeline for d2v7qi_: