Lineage for d2v7qb2 (2v7q B:95-379)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1596277Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1596728Protein automated matches [190393] (9 species)
    not a true protein
  7. 1596779Species Cow (Bos taurus) [TaxId:9913] [255271] (5 PDB entries)
  8. 1596781Domain d2v7qb2: 2v7q B:95-379 [238880]
    Other proteins in same PDB: d2v7qa1, d2v7qa3, d2v7qb1, d2v7qb3, d2v7qc1, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
    automated match to d1maba3
    complexed with adp, atp, mg, po4

Details for d2v7qb2

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (B:) ATP synthase subunit alpha heart isoform

SCOPe Domain Sequences for d2v7qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qb2 c.37.1.11 (B:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d2v7qb2:

Click to download the PDB-style file with coordinates for d2v7qb2.
(The format of our PDB-style files is described here.)

Timeline for d2v7qb2: