Lineage for d2v7qh2 (2v7q H:15-100)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561772Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 1561773Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 1561774Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 1561775Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
    delta subunit in mitochondria
  7. 1561776Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 1561778Domain d2v7qh2: 2v7q H:15-100 [152734]
    Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qi_, d2v7qj_
    automated match to d1e79h2
    complexed with adp, atp, mg, po4

Details for d2v7qh2

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (H:) ATP synthase delta chain

SCOPe Domain Sequences for d2v7qh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qh2 b.93.1.1 (H:15-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtl

SCOPe Domain Coordinates for d2v7qh2:

Click to download the PDB-style file with coordinates for d2v7qh2.
(The format of our PDB-style files is described here.)

Timeline for d2v7qh2: