Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins) this domain is inserted into a multihelical domain |
Protein BTV vp7, central (top) domain [49820] (1 species) |
Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries) |
Domain d2btvd2: 2btv D:121-254 [23783] Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1 |
PDB Entry: 2btv (more details), 3.5 Å
SCOPe Domain Sequences for d2btvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btvd2 b.19.1.1 (D:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]} parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn amvqiqvvfyismd
Timeline for d2btvd2:
View in 3D Domains from other chains: (mouse over for more information) d2btva_, d2btvb_, d2btvc1, d2btvc2, d2btve1, d2btve2, d2btvf1, d2btvf2, d2btvg1, d2btvg2, d2btvh1, d2btvh2, d2btvi1, d2btvi2, d2btvj1, d2btvj2, d2btvp1, d2btvp2, d2btvq1, d2btvq2, d2btvr1, d2btvr2, d2btvs1, d2btvs2, d2btvt1, d2btvt2 |