Lineage for d2btvd2 (2btv D:121-254)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778089Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
    this domain is inserted into a multihelical domain
  6. 1778090Protein BTV vp7, central (top) domain [49820] (1 species)
  7. 1778091Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)
  8. 1778099Domain d2btvd2: 2btv D:121-254 [23783]
    Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1

Details for d2btvd2

PDB Entry: 2btv (more details), 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core
PDB Compounds: (D:) protein (vp7 core protein)

SCOPe Domain Sequences for d2btvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btvd2 b.19.1.1 (D:121-254) BTV vp7, central (top) domain {Bluetongue virus [TaxId: 40051]}
parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn
amvqiqvvfyismd

SCOPe Domain Coordinates for d2btvd2:

Click to download the PDB-style file with coordinates for d2btvd2.
(The format of our PDB-style files is described here.)

Timeline for d2btvd2: