SCOP 1.55: Domain d2btvd2: 2btv D:121-254

Lineage for d2btvd2 (2btv D:121-254)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)

4. Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families)

5. Family b.19.1.1: Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49819] (1 protein)

6. Protein Virus coat protein vp7 (BTV-10 vp7), central (top) domain [49820] (2 species)

7. Species Bluetongue virus [TaxId:40051] [49821] (2 PDB entries)

8. Domain d2btvd2: 2btv D:121-254 [23783]
   Other proteins in same PDB: d2btva_, d2btvb_, d2btvc1, d2btvd1, d2btve1, d2btvf1, d2btvg1, d2btvh1, d2btvi1, d2btvj1, d2btvp1, d2btvq1, d2btvr1, d2btvs1, d2btvt1

Details for d2btvd2

PDB Entry: 2btv, 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

SCOP Domain Sequences for d2btvd2:

Sequence; same for both SEQRES and ATOM records:

>d2btvd2 b.19.1.1 (D:121-254) Virus coat protein vp7 (BTV-10 vp7), central (top) domain {Bluetongue virus}
parqpygffleteetfqpgrwfmraaqaatavvcgpdmiqvslnagargdvqqifqgrnd
pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvrnptqqn
amvqiqvvfyismd

Timeline for d2btvd2:

• d2btvd2 appears in SCOP 1.57
  
• d2btvd2 appears in the current release, SCOPe 2.08