Lineage for d3ga6b_ (3ga6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988263Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 2988272Domain d3ga6b_: 3ga6 B: [236713]
    automated match to d3g00a_
    protein/DNA complex; complexed with gol, na, po4

Details for d3ga6b_

PDB Entry: 3ga6 (more details), 1.9 Å

PDB Description: mth0212 in complex with two dna helices
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d3ga6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ga6b_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleie

SCOPe Domain Coordinates for d3ga6b_:

Click to download the PDB-style file with coordinates for d3ga6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ga6b_: