Lineage for d3ohra1 (3ohr A:1-118)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138226Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 2138261Protein Putative fructokinase YhdR [117642] (1 species)
  7. 2138262Species Bacillus subtilis [TaxId:1423] [117643] (4 PDB entries)
    Uniprot O05510
  8. 2138265Domain d3ohra1: 3ohr A:1-118 [233088]
    Other proteins in same PDB: d3ohra3
    automated match to d1xc3a1
    complexed with adp, so4, zn

Details for d3ohra1

PDB Entry: 3ohr (more details), 1.66 Å

PDB Description: Crystal structure of fructokinase from bacillus subtilis complexed with ADP
PDB Compounds: (A:) Putative fructokinase

SCOPe Domain Sequences for d3ohra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohra1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}
mlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfgp
vdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeak

SCOPe Domain Coordinates for d3ohra1:

Click to download the PDB-style file with coordinates for d3ohra1.
(The format of our PDB-style files is described here.)

Timeline for d3ohra1: