![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein Putative fructokinase YhdR [117642] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117643] (4 PDB entries) Uniprot O05510 |
![]() | Domain d3ohra1: 3ohr A:1-118 [233088] Other proteins in same PDB: d3ohra3 automated match to d1xc3a1 complexed with adp, so4, zn |
PDB Entry: 3ohr (more details), 1.66 Å
SCOPe Domain Sequences for d3ohra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ohra1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} mlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfgp vdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeak
Timeline for d3ohra1: