SCOPe 2.07: Domain d3ohra1: 3ohr A:1-118

Lineage for d3ohra1 (3ohr A:1-118)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein Putative fructokinase YhdR [117642] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [117643] (4 PDB entries)
   Uniprot O05510

8. Domain d3ohra1: 3ohr A:1-118 [233088]
   Other proteins in same PDB: d3ohra3
   automated match to d1xc3a1
   complexed with adp, so4, zn

Details for d3ohra1

PDB Entry: 3ohr, 1.66 Å

PDB Description: Crystal structure of fructokinase from bacillus subtilis complexed with ADP

PDB Compounds: (A:) Putative fructokinase

SCOPe Domain Sequences for d3ohra1:

Sequence; same for both SEQRES and ATOM records:

>d3ohra1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}
mlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfgp
vdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeak

Timeline for d3ohra1:

• d3ohra1 first appeared in SCOPe 2.03
  
• d3ohra1 appears in SCOPe 2.06
  
• d3ohra1 appears in the current release, SCOPe 2.08