SCOPe 2.06: Domain d2r9ua1: 2r9u A:22-190

Lineage for d2r9ua1 (2r9u A:22-190)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (11 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (6 PDB entries)

8. Domain d2r9ua1: 2r9u A:22-190 [231247]
   Other proteins in same PDB: d2r9ua2, d2r9ub2, d2r9uc2, d2r9ud2
   automated match to d2o6ra_

Details for d2r9ua1

PDB Entry: 2r9u, 2.1 Å

PDB Description: Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain

PDB Compounds: (A:) Variable lymphocyte receptor

SCOPe Domain Sequences for d2r9ua1:

Sequence; same for both SEQRES and ATOM records:

>d2r9ua1 c.10.2.0 (A:22-190) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlqqlyfn
snkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdcecrdim
ylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc

Timeline for d2r9ua1:

• d2r9ua1 first appeared in SCOPe 2.03, called d2r9ua_
  
• d2r9ua1 was called d2r9ua_ in SCOPe 2.05
  
• d2r9ua1 appears in SCOPe 2.07
  
• d2r9ua1 appears in the current release, SCOPe 2.08