Lineage for d2r9ua_ (2r9u A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353640Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1353641Protein automated matches [190787] (6 species)
    not a true protein
  7. 1353666Species Petromyzon marinus [TaxId:7757] [231246] (5 PDB entries)
  8. 1353668Domain d2r9ua_: 2r9u A: [231247]
    automated match to d2o6ra_

Details for d2r9ua_

PDB Entry: 2r9u (more details), 2.1 Å

PDB Description: Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain
PDB Compounds: (A:) Variable lymphocyte receptor

SCOPe Domain Sequences for d2r9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ua_ c.10.2.0 (A:) automated matches {Petromyzon marinus [TaxId: 7757]}
hhsagcpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlq
qlyfnsnkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdce
crdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc

SCOPe Domain Coordinates for d2r9ua_:

Click to download the PDB-style file with coordinates for d2r9ua_.
(The format of our PDB-style files is described here.)

Timeline for d2r9ua_: