Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (6 species) not a true protein |
Species Petromyzon marinus [TaxId:7757] [231246] (5 PDB entries) |
Domain d2r9ua_: 2r9u A: [231247] automated match to d2o6ra_ |
PDB Entry: 2r9u (more details), 2.1 Å
SCOPe Domain Sequences for d2r9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9ua_ c.10.2.0 (A:) automated matches {Petromyzon marinus [TaxId: 7757]} hhsagcpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlq qlyfnsnkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdce crdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc
Timeline for d2r9ua_: