Lineage for d2qlvc1 (2qlv C:7-185)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187447Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2187448Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2187449Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2187526Protein Nuclear protein SNF4 [143134] (1 species)
    duplication: comprises four CBS repeats
  7. 2187527Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143135] (3 PDB entries)
    Uniprot P12904 181-265
  8. 2187531Domain d2qlvc1: 2qlv C:7-185 [231213]
    Other proteins in same PDB: d2qlva1, d2qlvb1, d2qlvb2, d2qlvd_, d2qlve1, d2qlve2
    automated match to d2ooxe1

Details for d2qlvc1

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (C:) Nuclear protein SNF4

SCOPe Domain Sequences for d2qlvc1:

Sequence, based on SEQRES records: (download)

>d2qlvc1 d.37.1.1 (C:7-185) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
hpsrplfeaclkmlesrsgriplidqdeethreivvsvltqyrilkfvalncrethflk

Sequence, based on observed residues (ATOM records): (download)

>d2qlvc1 d.37.1.1 (C:7-185) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqekvsieqqlavesirkflnsktsydvlpvsyrlivldtsllvkkslnvllqnsivsap
lwdsktsrfaglltttdfinviqyyfsnpdkfelvdklqldglkdieralgvdqldtasi
hpsrplfeaclkmlesrsgriplidqreivvsvltqyrilkfvalncrethflk

SCOPe Domain Coordinates for d2qlvc1:

Click to download the PDB-style file with coordinates for d2qlvc1.
(The format of our PDB-style files is described here.)

Timeline for d2qlvc1: