![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries) |
![]() | Domain d1ehkb1: 1ehk B:41-168 [23041] Other proteins in same PDB: d1ehka_, d1ehkb2, d1ehkc_ complexed with 1cu, bng, cua, has, hem |
PDB Entry: 1ehk (more details), 2.4 Å
SCOP Domain Sequences for d1ehkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehkb1 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type} tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm fgtivvke
Timeline for d1ehkb1: