Lineage for d1ehkb1 (1ehk B:41-168)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11129Protein Cytochrome c oxidase [49544] (3 species)
  7. 11144Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)
  8. Domain d1ehkb1: 1ehk B:41-168 [23041]
    Other proteins in same PDB: d1ehka1, d1ehkb2, d1ehkc1

Details for d1ehkb1

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehkb1 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

SCOP Domain Coordinates for d1ehkb1 are not available.

Timeline for d1ehkb1:

Domains from same chain:
(mouse over for more information)
d1ehkb2
Domains from other chains:
(mouse over for more information)
d1ehka1, d1ehkc1