SCOP 1.55: Domain d1ehkb1: 1ehk B:41-168

Lineage for d1ehkb1 (1ehk B:41-168)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (3 families)

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (3 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (2 PDB entries)

8. Domain d1ehkb1: 1ehk B:41-168 [23041]
   Other proteins in same PDB: d1ehka1, d1ehkb2, d1ehkc1

Details for d1ehkb1

PDB Entry: 1ehk, 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb1:

Sequence; same for both SEQRES and ATOM records:

>d1ehkb1 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

SCOP Domain Coordinates for d1ehkb1 are not available.

Timeline for d1ehkb1:

• d1ehkb1 appears in SCOP 1.57
  
• d1ehkb1 appears in the current release, SCOPe 2.08