SCOPe 2.08: Domain d9pcya_: 9pcy A:

Lineage for d9pcya_ (9pcy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [49509] (1 PDB entry)

8. Domain d9pcya_: 9pcy A: [22854]
   complexed with cu

Details for d9pcya_

PDB Entry: 9pcy

PDB Description: high-resolution solution structure of reduced french bean plastocyanin and comparison with the crystal structure of poplar plastocyanin

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d9pcya_:

Sequence; same for both SEQRES and ATOM records:

>d9pcya_ b.6.1.1 (A:) Plastocyanin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
levllgsgdgslvfvpsefsvpsgekivfknnagfphnvvfdedeipagvdavkismpee
ellnapgetyvvtldtkgtysfycsphqgagmvgkvtvn

Timeline for d9pcya_:

• d9pcya_ first appeared (with stable ids) in SCOP 1.55, called d9pcy__
  
• d9pcya_ appears in SCOPe 2.07