Lineage for d9pcy__ (9pcy -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species French bean (Phaseolus vulgaris) [TaxId:3885] [49509] (1 PDB entry) 
Domain d9pcy__: 9pcy - [22854]
Details for d9pcy__
PDB Entry: 9pcy (more details)
PDB Description: high-resolution solution structure of reduced french bean plastocyanin and comparison with the crystal structure of poplar plastocyanin
SCOP Domain Sequences for d9pcy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d9pcy__ b.6.1.1 (-) Plastocyanin {French bean (Phaseolus vulgaris)}
levllgsgdgslvfvpsefsvpsgekivfknnagfphnvvfdedeipagvdavkismpee
ellnapgetyvvtldtkgtysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d9pcy__:
Click to download the PDB-style file with coordinates for d9pcy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9pcy__:
- d9pcy__ appears in SCOP 1.57
- d9pcy__ appears in the current release, SCOPe 2.08, called d9pcya_
View in 3D