Lineage for d4j57f_ (4j57 F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852662Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)
  8. 1852668Domain d4j57f_: 4j57 F: [227505]
    automated match to d1ep7a_
    complexed with fad, gol

Details for d4j57f_

PDB Entry: 4j57 (more details), 2.5 Å

PDB Description: structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
PDB Compounds: (F:) thioredoxin

SCOPe Domain Sequences for d4j57f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j57f_ c.47.1.1 (F:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

SCOPe Domain Coordinates for d4j57f_:

Click to download the PDB-style file with coordinates for d4j57f_.
(The format of our PDB-style files is described here.)

Timeline for d4j57f_: