Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries) |
Domain d4j57f_: 4j57 F: [227505] automated match to d1ep7a_ complexed with fad, gol |
PDB Entry: 4j57 (more details), 2.5 Å
SCOPe Domain Sequences for d4j57f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j57f_ c.47.1.1 (F:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]} vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs evtekenitsmptfkvykngssvdtllgandsalkqliekyaa
Timeline for d4j57f_: