SCOPe 2.06: Domain d4j57f_: 4j57 F:

Lineage for d4j57f_ (4j57 F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)

8. Domain d4j57f_: 4j57 F: [227505]
   automated match to d1ep7a_
   complexed with fad, gol

Details for d4j57f_

PDB Entry: 4j57, 2.5 Å

PDB Description: structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex

PDB Compounds: (F:) thioredoxin

SCOPe Domain Sequences for d4j57f_:

Sequence; same for both SEQRES and ATOM records:

>d4j57f_ c.47.1.1 (F:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

Timeline for d4j57f_:

• d4j57f_ first appeared in SCOPe 2.03
  
• d4j57f_ appears in SCOPe 2.05
  
• d4j57f_ appears in SCOPe 2.07
  
• d4j57f_ appears in the current release, SCOPe 2.08