Lineage for d1nfia2 (1nfi A:20-189)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041213Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2041217Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry)
  8. 2041218Domain d1nfia2: 1nfi A:20-189 [22455]
    Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_

Details for d1nfia2

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (A:) nf-kappa-b p65

SCOPe Domain Sequences for d1nfia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfia2 b.2.5.3 (A:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap

SCOPe Domain Coordinates for d1nfia2:

Click to download the PDB-style file with coordinates for d1nfia2.
(The format of our PDB-style files is described here.)

Timeline for d1nfia2: