| Class b: All beta proteins [48724] (93 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) |
Superfamily b.2.5: p53-like transcription factors [49417] (1 family) ![]() |
| Family b.2.5.1: p53-like transcription factors [49418] (10 proteins) |
| Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry) |
| Domain d1nfia2: 1nfi A:20-189 [22455] Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOP Domain Sequences for d1nfia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfia2 b.2.5.1 (A:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens)}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap
Timeline for d1nfia2: