SCOPe 2.06: Domain d1nfic1: 1nfi C:190-320

Lineage for d1nfic1 (1nfi C:190-320)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49255] (1 PDB entry)

8. Domain d1nfic1: 1nfi C:190-320 [21943]
   Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_

Details for d1nfic1

PDB Entry: 1nfi, 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

PDB Compounds: (C:) nf-kappa-b p65

SCOPe Domain Sequences for d1nfic1:

Sequence; same for both SEQRES and ATOM records:

>d1nfic1 b.1.18.1 (C:190-320) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva
ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf
ksimkkspfsg

Timeline for d1nfic1:

• d1nfic1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfic1 appears in SCOPe 2.05
  
• d1nfic1 appears in SCOPe 2.07
  
• d1nfic1 appears in the current release, SCOPe 2.08