![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) ![]() automatically mapped to Pfam PF01324 |
![]() | Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
![]() | Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries) |
![]() | Domain d1xdtt1: 1xdt T:381-535 [22385] Other proteins in same PDB: d1xdtr_, d1xdtt2, d1xdtt3 |
PDB Entry: 1xdt (more details), 2.65 Å
SCOPe Domain Sequences for d1xdtt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdtt1 b.2.1.1 (T:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d1xdtt1: