SCOPe 2.08: Domain d1xdtt3: 1xdt T:200-380

Lineage for d1xdtt3 (1xdt T:200-380)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)

6. Protein Diphtheria toxin, middle domain [56847] (1 species)
   contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)

7. Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)

8. Domain d1xdtt3: 1xdt T:200-380 [43390]
   Other proteins in same PDB: d1xdtr_, d1xdtt1, d1xdtt2

Details for d1xdtt3

PDB Entry: 1xdt, 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor

PDB Compounds: (T:) diphtheria toxin

SCOPe Domain Sequences for d1xdtt3:

Sequence; same for both SEQRES and ATOM records:

>d1xdtt3 f.1.2.1 (T:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Timeline for d1xdtt3:

• d1xdtt3 first appeared (with stable ids) in SCOP 1.55
  
• d1xdtt3 appears in SCOPe 2.07