Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) automatically mapped to Pfam PF01324 |
Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries) |
Domain d1f0lb1: 1f0l B:381-535 [22378] Other proteins in same PDB: d1f0la2, d1f0la3, d1f0lb2, d1f0lb3 complexed with apu, cl |
PDB Entry: 1f0l (more details), 1.55 Å
SCOPe Domain Sequences for d1f0lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0lb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d1f0lb1: