Lineage for d1f0lb1 (1f0l B:381-535)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10321Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) (S)
  5. 10322Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 10323Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 10324Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries)
  8. 10326Domain d1f0lb1: 1f0l B:381-535 [22378]
    Other proteins in same PDB: d1f0la2, d1f0la3, d1f0lb2, d1f0lb3

Details for d1f0lb1

PDB Entry: 1f0l (more details), 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin

SCOP Domain Sequences for d1f0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0lb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOP Domain Coordinates for d1f0lb1:

Click to download the PDB-style file with coordinates for d1f0lb1.
(The format of our PDB-style files is described here.)

Timeline for d1f0lb1: