Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries) |
Domain d4g3sa2: 4g3s A:264-474 [221695] Other proteins in same PDB: d4g3sa1 automated match to d1g95a1 complexed with co, gn1, mg, pop, ud1 |
PDB Entry: 4g3s (more details), 2.04 Å
SCOPe Domain Sequences for d4g3sa2:
Sequence, based on SEQRES records: (download)
>d4g3sa2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp pgalavsagpqrnienwvqrkrpgspaaqas
>d4g3sa2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi geysnigassvfvnrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavs agpqrnienwvqrkrpgspaaqas
Timeline for d4g3sa2: