Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (32 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226416] (1 PDB entry) |
Domain d4egja2: 4egj A:103-311 [220507] Other proteins in same PDB: d4egja1, d4egjb1, d4egjc1, d4egjd1 automated match to d1e4ea2 |
PDB Entry: 4egj (more details), 2.3 Å
SCOPe Domain Sequences for d4egja2:
Sequence, based on SEQRES records: (download)
>d4egja2 d.142.1.0 (A:103-311) automated matches {Burkholderia xenovorans [TaxId: 266265]} dkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavikvk sadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyhakyi andtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevntapgm tdhslppkaaravgisyqelvvavlaltl
>d4egja2 d.142.1.0 (A:103-311) automated matches {Burkholderia xenovorans [TaxId: 266265]} dkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasikvksadalpa alieavkfdrivvveksiegggeytaciagnldlpvirivpqylipcgltadeearlkvl arrafdvlgctdwgradfmldadgnpyflevntapgmtdhslppkaaravgisyqelvva vlaltl
Timeline for d4egja2: