PDB entry 4egj

View 4egj on RCSB PDB site
Description: Crystal structure of D-alanine-D-alanine ligase from Burkholderia xenovorans
Class: ligase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, D-alanine-D-alanine ligase, ligase
Deposited on 2012-03-31, released 2012-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_A3907, Bxe_A0488, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egja1, d4egja2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_A3907, Bxe_A0488, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egjb1, d4egjb2
  • Chain 'C':
    Compound: d-alanine--d-alanine ligase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_A3907, Bxe_A0488, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egjc1, d4egjc2
  • Chain 'D':
    Compound: d-alanine--d-alanine ligase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_A3907, Bxe_A0488, ddl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4egjd1, d4egjd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4egjA (A:)
    mahhhhhhmgtleaqtqgpgsmssidpkqfgkvavllggnsaerevslnsgrlvlqglrd
    agidahpfdpaerplaalkeegfvrafnalhggygengqiqgaldfygirytgsgvlgsa
    lgldkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavi
    kvksadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyha
    kyiandtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevnta
    pgmtdhslppkaaravgisyqelvvavlaltlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egjA (A:)
    idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqlgiptppfea
    vlrgddyearakeivaklglplfvkpasikvksadalpaalieavkfdrivvveksiegg
    geytaciagnldlpvirivpqylipcgltadeearlkvlarrafdvlgctdwgradfmld
    adgnpyflevntapgmtdhslppkaaravgisyqelvvavlaltl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4egjB (B:)
    mahhhhhhmgtleaqtqgpgsmssidpkqfgkvavllggnsaerevslnsgrlvlqglrd
    agidahpfdpaerplaalkeegfvrafnalhggygengqiqgaldfygirytgsgvlgsa
    lgldkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavi
    kvksadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyha
    kyiandtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevnta
    pgmtdhslppkaaravgisyqelvvavlaltlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egjB (B:)
    idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqlgiptppfea
    vlrgddyearakeivaklglplfvkpaseikvksadalpaalieavkfdrivvveksieg
    ggeytaciagnldlpvirivqylipcgltadeearlkvlarrafdvlgctdwgradfmld
    adgnpyflevntapgmtdhslppkaaravgisyqelvvavlaltl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4egjC (C:)
    mahhhhhhmgtleaqtqgpgsmssidpkqfgkvavllggnsaerevslnsgrlvlqglrd
    agidahpfdpaerplaalkeegfvrafnalhggygengqiqgaldfygirytgsgvlgsa
    lgldkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavi
    kvksadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyha
    kyiandtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevnta
    pgmtdhslppkaaravgisyqelvvavlaltlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egjC (C:)
    idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqlgiptppfea
    vlrgddyearalglplfvkikvksadalpaalieavkfdrivvveksiegggeytaciag
    nldlpvirivpagendtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadg
    npyflevntapgmtdhslppkaaravgisyqelvvavlaltlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4egjD (D:)
    mahhhhhhmgtleaqtqgpgsmssidpkqfgkvavllggnsaerevslnsgrlvlqglrd
    agidahpfdpaerplaalkeegfvrafnalhggygengqiqgaldfygirytgsgvlgsa
    lgldkfrtklvwqqlgiptppfeavlrgddyearakeivaklglplfvkpasegssvavi
    kvksadalpaalieavkfdrivvveksiegggeytaciagnldlpvirivpagefydyha
    kyiandtqylipcgltadeearlkvlarrafdvlgctdwgradfmldadgnpyflevnta
    pgmtdhslppkaaravgisyqelvvavlaltlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egjD (D:)
    sidpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegf
    vrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqlgiptppfe
    aglplfvkvvveksiegggeytaciagnldlpvirivpatqylipcgltadeearlkvla
    rrafdvlgctdwgradfmldadgnpyflevntapgmtdhslppkaaravgisyqelvvav
    laltlk