Lineage for d4e4ja_ (4e4j A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213947Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2213948Protein automated matches [190175] (9 species)
    not a true protein
  7. 2214000Species Mycoplasma penetrans [TaxId:272633] [226512] (1 PDB entry)
  8. 2214001Domain d4e4ja_: 4e4j A: [220288]
    automated match to d1rxxa_
    complexed with cl

Details for d4e4ja_

PDB Entry: 4e4j (more details), 2.3 Å

PDB Description: Crystal structure of arginine deiminase from Mycoplasma penetrans
PDB Compounds: (A:) Arginine deiminase

SCOPe Domain Sequences for d4e4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ja_ d.126.1.0 (A:) automated matches {Mycoplasma penetrans [TaxId: 272633]}
ginvyseigelkevlvhtpgdeirytapsrleellfsavlkadtaieehkgfvkilqnng
ikviqlcdlvaetyelcskevrnsfieqyldealpvlkkeirpvvkdyllsfptvqmvrk
mmsgilanelnikqdnpliidgmpnlyftrdpfasmgngvsincmkyptrkrevifsrfv
ftnnpkykntpryfdivgnngtieggdifiynsktlvignsertnfaaiesvakniqank
dctferivvinvppmpnlmhldtwltmldydkflyspnmmnvlkiweidlnvkpvkfvek
kgtleevlysiidkkpilipiagkganqldidiethfdgtnyltiapgvvvgyernektq
kalveagikvlsfngsqlslgmgsarcmsmplirenlkk

SCOPe Domain Coordinates for d4e4ja_:

Click to download the PDB-style file with coordinates for d4e4ja_.
(The format of our PDB-style files is described here.)

Timeline for d4e4ja_: