Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
Protein automated matches [190175] (9 species) not a true protein |
Species Mycoplasma penetrans [TaxId:272633] [226512] (1 PDB entry) |
Domain d4e4jl_: 4e4j L: [220299] automated match to d1rxxa_ complexed with cl |
PDB Entry: 4e4j (more details), 2.3 Å
SCOPe Domain Sequences for d4e4jl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4jl_ d.126.1.0 (L:) automated matches {Mycoplasma penetrans [TaxId: 272633]} ginvyseigelkevlvhtpgdeirytapsrleellfsavlkadtaieehkgfvkilqnng ikviqlcdlvaetyelcskevrnsfieqyldealpvlkkeirpvvkdyllsfptvqmvrk mmsgilanelnikqdnpliidgmpnlyftrdpfasmgngvsincmkyptrkrevifsrfv ftnnpkykntpryfdivgnngtieggdifiynsktlvignsertnfaaiesvakniqank dctferivvinvppmpnlmhldtwltmldydkflyspnmmnvlkiweidlnvkpvkfvek kgtleevlysiidkkpilipiagkganqldidiethfdgtnyltiapgvvvgyernektq kalveagikvlsfngsqlslgmgsarcmsmplirenlkk
Timeline for d4e4jl_: