Lineage for d4dfpa2 (4dfp A:423-832)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1951568Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1951569Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1951635Species Thermus aquaticus [TaxId:271] [56676] (26 PDB entries)
  8. 1951642Domain d4dfpa2: 4dfp A:423-832 [219741]
    Other proteins in same PDB: d4dfpa1
    automated match to d1jxea2
    protein/DNA complex; complexed with 0l7, edo, fmt, mg

Details for d4dfpa2

PDB Entry: 4dfp (more details), 2 Å

PDB Description: Crystal structure of the large fragment of DNA Polymerase I from Thermus aqauticus in a ternary complex with 7-(aminopentinyl)-7-deaza-dGTP
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4dfpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dfpa2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d4dfpa2:

Click to download the PDB-style file with coordinates for d4dfpa2.
(The format of our PDB-style files is described here.)

Timeline for d4dfpa2: