Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein DNA polymerase I (Klenow fragment) [56674] (3 species) |
Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries) |
Domain d4dfpa2: 4dfp A:423-832 [219741] Other proteins in same PDB: d4dfpa1 automated match to d1jxea2 protein/DNA complex; complexed with 0l7, edo, fmt, mg |
PDB Entry: 4dfp (more details), 2 Å
SCOPe Domain Sequences for d4dfpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dfpa2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
Timeline for d4dfpa2: